Anti-FOXN1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 586-600 amino acids of Human forkhead box N1 |
Anti-FOXN1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 586-600 amino acids of Human forkhead box N1 |
FOXN1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated corresponding to Human Forkhead box N1. |
FOXN1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 357-386 amino acids from the Central region of human FOXN1 |
Anti-FOXN1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 586-600 amino acids of Human forkhead box N1 |
Rabbit polyclonal antibody to FOXN1 (forkhead box N1)
Applications | WB |
Reactivities | Human (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 585 and 648 of FOXN1 (Uniprot ID#O15353) |
Goat Polyclonal Antibody against FOXN1
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SVYLSPSSKPVALA, from the C Terminus of the protein sequence according to NP_003584. |
Rabbit Polyclonal anti-FOXN1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXN1 antibody: synthetic peptide directed towards the N terminal of human FOXN1. Synthetic peptide located within the following region: FVSDGPPERTPSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYP |