Mouse Monoclonal DNMT1 Antibody (60B1220.1)
Applications | ChIP, CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Mouse Monoclonal DNMT1 Antibody (60B1220.1)
Applications | ChIP, CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against FOXC1
Applications | FC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1. |
Rabbit Polyclonal Antibody against TARDBP
Applications | ELISA, ICC/IF, IHC, WB |
Reactivities | Human, Primate, Mouse, Xenopus, Zebrafish, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148] |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
Applications | IF, IHC, IP, WB |
Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal Antibody against SOX2 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Zebrafish, Chicken, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit Polyclonal Anti-ESRRG Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Bat, Xenopus, Zebrafish) |
Conjugation | Unconjugated |
Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 15 amino acid peptide from C-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Lizard (100%); Bat, Xenopus, Zebrafish (93%); Stickleback, Medaka, Pufferfish (87%). |
Rabbit polyclonal anti-TBP antibody, Loading control
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the C-terminus of human PPARD |
Rabbit Polyclonal anti-FOSL2 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Rabbit Polyclonal SOX17 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Opossum, Primate, Zebrafish |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 70-120 of human SOX17 was used as the immunogen for the antibody. |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Zebrafish, Chicken, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit polyclonal CAF-1 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Rabbit polyclonal SMAD2 Antibody
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Rat, Zebrafish, Bovine, Chicken, Drosophila, Pig) |
Conjugation | Unconjugated |
Immunogen | This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2. |
NAB1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NAB1 antibody: synthetic peptide directed towards the N terminal of human NAB1. |
Mouse monoclonal DNMT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |