Antibodies

View as table Download

PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit Polyclonal NFATC1/NFAT2 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Amino acids 264-282 (NKRKYSLNGRQPPYSPHHS) of human NFATc1 were used as immunogen for this antibody.

Anti-NFATC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-15 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2

Anti-NFAT5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 711-724 amino acids of Human nuclear factor of activated T-cells 5, tonicity-responsive

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

Rabbit Polyclonal Anti-NFATC3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NFATC3

NFAT2 (NFATC1) mouse monoclonal antibody, clone AT1C3, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

NFAT2 (NFATC1) mouse monoclonal antibody, clone AT1C3, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-NFATC1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1

c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NFATC2 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human NFATC2