Mouse monoclonal anti-HSP90AB1(HSP90) antibody, clone 4C10, Load, clone OTI4C10 (formerly 4C10)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
Mouse monoclonal anti-HSP90AB1(HSP90) antibody, clone 4C10, Load, clone OTI4C10 (formerly 4C10)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
Mouse monoclonal anti-HSP90AB1(HSP90) antibody, clone 4C10, Load, clone OTI4C10 (formerly 4C10)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA8 Antibody
Applications | IHC, WB |
Reactivities | Rat, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
USD 509.00
2 Weeks
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
HSPA8 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) HSP90AB1 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog, Monkey |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Rabbit Polyclonal HSP90 beta Antibody
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human Hsp90B protein (between residues 650-724) [UniProt P08238] |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Pig) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Rabbit polyclonal HSP90B (Ab-254) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Modifications | Phospho-specific |
HSP90AB1 (250-325) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Canine, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide between aa 250-325 in the sequence of human Hsp90 |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Bovine, Fish, Rabbit, Chicken, Xenopus, Drosophila, Yeast, Beluga, Hamster, Guinea Pig |
Conjugation | Unconjugated |