Antibodies

View as table Download

Anti-NPPC Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 111-125 amino acids of Human notch 4

Rabbit Polyclonal Anti-NPPC Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nppc antibody is: synthetic peptide directed towards the C-terminal region of Nppc. Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS