Antibodies

View as table Download

LRG1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human LRG1

Rabbit polyclonal anti-LRG1 (A2GL) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human A2GL.

Rabbit Polyclonal Anti-LRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRG1 antibody: synthetic peptide directed towards the N terminal of human LRG1. Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP