LRG1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human LRG1 |
LRG1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human LRG1 |
Rabbit polyclonal anti-LRG1 (A2GL) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human A2GL. |
Rabbit Polyclonal Anti-LRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LRG1 antibody: synthetic peptide directed towards the N terminal of human LRG1. Synthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP |