Antibodies

Jump to Filters
View as table Download
Galanin (GAL) (Center) Rabbit Polyclonal Antibody
AP51760PU-N

USD 580.00

2 Weeks

Galanin (GAL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 55-86 amino acids from the Central region of human GAL
Galanin (GAL) Goat Polyclonal Antibody
TA311451

USD 520.00

2 Weeks

Goat Anti-GAL Antibody

Applications IHC, PEP-ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HRSFSDKNGLTSK, from the internal region of the protein sequence according to NP_057057.2.
Galanin (GAL) Rabbit Polyclonal Antibody
TA330441

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN