Rabbit Polyclonal Anti-FGL1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FGL1 |
Rabbit Polyclonal Anti-FGL1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FGL1 |
FGL1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide from the C-terminal region ( between 225-256 aa) of human FGL1. |
Goat Anti-FGL1 / Hepassocin Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ETRVKQQQVKIKQ, from the internal region of the protein sequence according to NP_004458.3. |
Rabbit Polyclonal Anti-FGL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGL1 antibody: synthetic peptide directed towards the middle region of human FGL1. Synthetic peptide located within the following region: EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL |