Antibodies

Jump to Filters
View as table Download
FGL1 Rabbit Polyclonal Antibody
TA349318

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-FGL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGL1
FGL1 (C-term) Rabbit Polyclonal Antibody
AP51664PU-N

USD 580.00

2 Weeks

FGL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide from the C-terminal region ( between 225-256 aa) of human FGL1.
FGL1 Goat Polyclonal Antibody
TA311300

USD 520.00

5 Days

Goat Anti-FGL1 / Hepassocin Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETRVKQQQVKIKQ, from the internal region of the protein sequence according to NP_004458.3.
FGL1 Rabbit Polyclonal Antibody
TA338186

USD 539.00

5 Days

Rabbit Polyclonal Anti-FGL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGL1 antibody: synthetic peptide directed towards the middle region of human FGL1. Synthetic peptide located within the following region: EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL