USD 509.00
2 Weeks
CHIA mouse monoclonal antibody,clone OTI1B8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
CHIA mouse monoclonal antibody,clone OTI1B8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
CHIA mouse monoclonal antibody,clone OTI3H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CHIA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL |
AMCase (CHIA) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 20-47 amino acids from the N-terminal region of human CHIA. |
CHIA mouse monoclonal antibody,clone OTI3G3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against CHIT1 (aa409-423)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EHGPSPGQDTFCQGK, from the internal region (near C Terminus) of the protein sequence according to NP_003456.1. |
CHIT1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CHIT1 |
Rabbit polyclonal antibody to Chitotriosidase (chitinase 1 (chitotriosidase))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 216 and 463 of Chitotriosidase (Uniprot ID#Q13231) |
Rabbit Polyclonal anti-CHIA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP |
CHIT1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CHIT1 |
CHIA mouse monoclonal antibody,clone OTI3D8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CHIA mouse monoclonal antibody,clone OTI1B8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |