Anti-PTHLH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone |
Anti-PTHLH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone |
Anti-PTHLH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 37-177 amino acids of human parathyroid hormone-like hormone |
Rabbit Polyclonal Anti-Pthlh Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pthlh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK |