Germany
Japan
United Kingdom
China
c Abl (ABL1) pTyr204 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
FYN pTyr530 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FYN rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
PKC alpha (PRKCA) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal c-Abl Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Abl |
Rabbit polyclonal Anti-FYN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FYN antibody: synthetic peptide directed towards the middle region of human FYN. Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN |
Rabbit anti Rho Kinase/ROCKII (pT396) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Chicken, Bovine, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -VETFP- with a single phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (Paired T396) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Chicken, Bovine, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -VETFP- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (IN) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Chicken, Bovine, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide (19mer) derived from 250-350 amino acids of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (pT249) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Chicken, Bovine, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -CDTAV- with a single phosphorylation site Thr249 of human Rho Kinase/RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (Paired T249) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Chicken, Bovine, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -CDTAV- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit polyclonal ABL1 (Thr735) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ABL1 around the phosphorylation site of threonine 735 (S-V-TP-L-P). |
| Modifications | Phospho-specific |
ROCK2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human ROCK2 |
Mouse Monoclonal Fyn Antibody
| Applications | IF, WB |
| Reactivities | Human, Monkey, Rat, Mouse |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Families
- Protein Kinase
Pathways
- Pathogenic Escherichia coli infection