Antibodies

Jump to Filters
View as table Download
SCY1 like 3 (SCYL3) Rabbit Polyclonal Antibody
TA308183

USD 625.00

5 Days

Rabbit polyclonal antibody to SCY1 like 3 (SCY1-like 3 (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 80 and 549 of SCY1 like 3 (Uniprot ID#Q8IZE3)
SCY1 like 3 (SCYL3) Mouse Monoclonal Antibody [Clone ID: OTI4F10]
TA500493S

USD 200.00

In Stock

Anti-SCYL3 mouse monoclonal antibody, clone OTI4F10 (formerly 4F10)

Applications IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
SCY1 like 3 (SCYL3) Rabbit Polyclonal Antibody
TA344608

USD 539.00

5 Days

Rabbit Polyclonal Anti-SCYL3 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Scyl3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC
SCY1 like 3 (SCYL3) Rabbit Polyclonal Antibody
TA344609

USD 539.00

5 Days

Rabbit Polyclonal Anti-SCYL3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCYL3 antibody: synthetic peptide directed towards the N terminal of human SCYL3. Synthetic peptide located within the following region: MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
SCY1 like 3 (SCYL3) Mouse Monoclonal Antibody [Clone ID: OTI7E7]
TA500489S

USD 200.00

2 Days

Anti-SCYL3 mouse monoclonal antibody, clone OTI7E7 (formerly 7E7)

Applications WB
Reactivities Human
Conjugation Unconjugated