Antibodies

Jump to Filters
View as table Download
Carboxypeptidase B2 (CPB2) Mouse Monoclonal Antibody [Clone ID: OTI3D5]
TA807474

USD 447.00

In Stock

CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Carboxypeptidase B2 (CPB2) Mouse Monoclonal Antibody [Clone ID: OTI3D5]
CF807474

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
AP17235PU-N

USD 580.00

2 Weeks

Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
TA313671

USD 380.00

4 Weeks

Rabbit polyclonal anti-CPB2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CPB2.
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
TA332132

USD 539.00

5 Days

Rabbit Polyclonal Anti-CPB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
TA361288

USD 539.00

5 Days

CPB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPB2