Antibodies

Jump to Filters
View as table Download
TASP1 Rabbit Polyclonal Antibody
TA347304

USD 430.00

5 Days

Rabbit Polyclonal TASP1 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TASP1 antibody: mouse human TASP1 (Threonine aspartase 1), using three KLH-conjugated synthetic peptides: two containing an amino acid sequence from the N-terminal part of the protein and one containing an amino acid sequence from t
TASP1 Rabbit Polyclonal Antibody
TA344970

USD 539.00

5 Days

Rabbit Polyclonal Anti-TASP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TASP1 antibody: synthetic peptide directed towards the middle region of human TASP1. Synthetic peptide located within the following region: QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI