Germany
Japan
United Kingdom
China
PP2A-alpha (PPP2CA) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The purified peptide conjugated to KLH. |
Antibodies
View as table Download
Goat Polyclonal Antibody against PPP2CA / PPP2CB
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Rabbit, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1. |
Goat Polyclonal Antibody against PPP2R5D
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236. |
Goat Polyclonal Antibody against PPP2R5A
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AYNMHSILSNTSAE, from the C Terminus of the protein sequence according to NP_006234.1. |
Rabbit Polyclonal antibody to PPP2R5B (protein phosphatase 2, regulatory subunit B', beta isoform)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 434 and 497 of PPP2R5B (Uniprot ID#Q15173) |
Rabbit polyclonal anti-PPP2R5D antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D. |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A purified peptide conjugated to KLH |
PPP2R5D rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from the N-terminus of PP2A/B delta |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is the purified peptide conjugated to KLH. |
Active filters
Reactivities
- Rat
Isotypes
- IgG
Families
- Phosphatase
Pathways
- Wnt signaling pathway