USD 447.00
In Stock
CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 447.00
In Stock
CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 600.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 200.00
In Stock
CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | HRP |
Anti-CYP1B1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human cytochrome P450, family 1, subfamily B, polypeptide 1 |
Rabbit polyclonal CYP1A2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2E1 |
CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1. |
Rabbit polyclonal Cytochrome P450 2S1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2S1. |
Anti-CYP1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1 |
Rabbit polyclonal Cytochrome P450 2E1 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1. |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 3A4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A4. |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |