Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 23 results

Page 1 of 2

(reset)

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

TA504328

USD 447.00

In Stock

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

CF504328

USD 600.00

In Stock

Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

TA504328S

USD 200.00

In Stock

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D5]

TA504328AM

USD 509.00

2 Weeks

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytochrome P450 2B6 (CYP2B6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D5]

TA504328BM

USD 509.00

2 Weeks

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CYP1B1 Rabbit Polyclonal Antibody

TA321055

USD 380.00

In Stock

Anti-CYP1B1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 250 amino acids of human cytochrome P450, family 1, subfamily B, polypeptide 1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytochrome P450 1A2 (CYP1A2) Rabbit Polyclonal Antibody

TA324397

USD 580.00

5 Days

Rabbit polyclonal CYP1A2 Antibody (Center)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2.

1 / 3

2 / 3

3 / 3

Previous Next

Cytochrome P450 2E1 (CYP2E1) Rabbit Polyclonal Antibody

TA349845

USD 380.00

In Stock

Rabbit Polyclonal Anti-CYP2E1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CYP2E1

1 / 3

2 / 3

3 / 3

Previous Next

CYP1A1 (+CYP1A2) Rabbit Polyclonal Antibody

AP20396PU-N

USD 465.00

3 Weeks

CYP1A1 (+CYP1A2) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to amino acids 71-120 of Human CYP1A1.

CYP2S1 Rabbit Polyclonal Antibody

TA311700

USD 380.00

4 Weeks

Rabbit polyclonal Cytochrome P450 2S1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2S1.

1 / 3

2 / 3

3 / 3

Previous Next

CYP1A1 Rabbit Polyclonal Antibody

TA321142

USD 380.00

4 Weeks

Anti-CYP1A1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human cytochrome P450, family 1, subfamily A, polypeptide 1

1 / 3

2 / 3

3 / 3

Previous Next

Cytochrome P450 2E1 (CYP2E1) Rabbit Polyclonal Antibody

TA311804

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 2E1 antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1.
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody

TA313730

USD 380.00

2 Weeks

Rabbit polyclonal Cytochrome P450 3A4 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A4.

1 / 2

2 / 2

Previous Next

CYP1A1 Rabbit Polyclonal Antibody

TA346040

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

1 / 2

2 / 2

Previous Next

CYP1A1 Rabbit Polyclonal Antibody

TA346041

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP1A1 Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV

1 / 2

2 / 2

Previous Next

1 - 15 of 23 results

Page 1 of 2