USD 447.00
In Stock
RARG mouse monoclonal antibody, clone OTI3G1. This antibody can recognize both RARG isoform 1 (NM_000966) and isoform 2 (NM_001042728)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
RARG mouse monoclonal antibody, clone OTI3G1. This antibody can recognize both RARG isoform 1 (NM_000966) and isoform 2 (NM_001042728)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) RARG mouse monoclonal antibody,clone OTI3G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
RARG mouse monoclonal antibody,clone OTI3G1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
RARG mouse monoclonal antibody,clone OTI3G1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal antibody to Retinoic Acid Receptor gamma (retinoic acid receptor, gamma)
Applications | IF |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 119 and 454 of Retinoic Acid Receptor gamma |
USD 200.00
In Stock
RARG mouse monoclonal antibody,clone OTI3G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RARG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RARG antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPR |
Rabbit Polyclonal Anti-RARG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the middle region of human RARG. Synthetic peptide located within the following region: QYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITK |
Rabbit Polyclonal Anti-RARG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: YPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTS |