Antibodies

Jump to Filters
View as table Download
ROR beta (RORB) Rabbit Polyclonal Antibody
TA351610

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-RORB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RORB
ROR beta (RORB) Rabbit Polyclonal Antibody
TA343643

USD 539.00

5 Days

Rabbit Polyclonal Anti-RORB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK
ROR beta (RORB) Rabbit Polyclonal Antibody
TA317258

USD 515.00

2 Weeks

RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Dog, Gorilla, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Gibbon, Hamster, Horse (Predicted: Xenopus)
Conjugation Unconjugated
Immunogen RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%).
ROR beta (RORB) Mouse Monoclonal Antibody [Clone ID: OTI4B12]
TA806859S

USD 200.00

2 Days

RORB mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ROR beta (RORB) Mouse Monoclonal Antibody [Clone ID: OTI3D7]
TA806860S

USD 200.00

2 Days

RORB mouse monoclonal antibody, clone OTI3D7 (formerly 3D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated