Antibodies

View as table Download

Rabbit Polyclonal Anti-NR1H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD

Goat Polyclonal Antibody against NR1H2

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence SSPTTSSLDTPLPGC, from the N Terminus of the protein sequence according to NP_009052.

Rabbit Polyclonal LXR-B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LXR-B antibody was raised against a 14 amino acid peptide from near the amino terminus human LXR-B.

Rabbit Polyclonal Anti-Nr1h2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nr1h2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Nr1h2. Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL

Rabbit Polyclonal Anti-NR1H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR1H2 Antibody: synthetic peptide directed towards the middle region of human NR1H2. Synthetic peptide located within the following region: ETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYAL

Rabbit Polyclonal Anti-NR1H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTD

Rabbit Polyclonal Anti-NR1H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the middle region of human NR1H2. Synthetic peptide located within the following region: MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI