Antibodies

View as table Download

TOMM40L mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOMM40L mouse monoclonal antibody,clone OTI5B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOMM40L mouse monoclonal antibody,clone OTI5D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI5B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI5D9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOMM40L mouse monoclonal antibody,clone OTI5B1, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TOMM40L mouse monoclonal antibody,clone OTI5D9, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TOMM40L mouse monoclonal antibody,clone OTI6F3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit Polyclonal Anti-TOMM40L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD

Rabbit Polyclonal Anti-TOMM40L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGL

TOMM40L mouse monoclonal antibody,clone OTI5B1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated