TOMM40L mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TOMM40L mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TOMM40L mouse monoclonal antibody,clone OTI5B1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TOMM40L mouse monoclonal antibody,clone OTI5D9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI5B1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI5D9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TOMM40L mouse monoclonal antibody,clone OTI6F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TOMM40L mouse monoclonal antibody,clone OTI5B1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TOMM40L mouse monoclonal antibody,clone OTI5B1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
TOMM40L mouse monoclonal antibody,clone OTI5D9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TOMM40L mouse monoclonal antibody,clone OTI5D9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
TOMM40L mouse monoclonal antibody,clone OTI6F3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TOMM40L mouse monoclonal antibody,clone OTI6F3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-TOMM40L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD |
Rabbit Polyclonal Anti-TOMM40L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGL |
TOMM40L mouse monoclonal antibody,clone OTI5B1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |