Rabbit polyclonal GABRA2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal Anti-HTR3B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT |
Rabbit Polyclonal Anti-GABRD Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
Rabbit Polyclonal Anti-GABRP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit polyclonal CHRNA3 Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This CHRNA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 25-52 amino acids from the N-terminal region of human CHRNA3. |
Rabbit Polyclonal Anti-CHRND Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
USD 485.00
2 Weeks
Rabbit Polyclonal Anti-CHRNB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2. Synthetic peptide located within the following region: CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD |
USD 520.00
5 Days
Goat Anti-CHRNB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1. |
Rabbit Polyclonal Anti-HTR3A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG |
Rabbit Polyclonal Anti-GABRP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit Polyclonal Anti-GABRA3 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT |
Rabbit Polyclonal Anti-HTR3E Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR3E antibody: synthetic peptide directed towards the middle region of human HTR3E. Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG |
Germany
Japan
United Kingdom
China
