Rabbit Polyclonal Anti-F2RL2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human F2RL2 |
Rabbit Polyclonal Anti-F2RL2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human F2RL2 |
USD 580.00
2 Weeks
Proteinase Activated Receptor 3 (F2RL2) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 20-50 amino acids from the N-terminal region of human F2RL2 |
Rabbit Polyclonal Anti-F2RL2 Antibody (Internal)
Applications | IHC |
Reactivities | Human (Predicted: Monkey, Bovine) |
Conjugation | Unconjugated |
Immunogen | F2RL2 / PAR3 antibody was raised against synthetic 19 amino acid peptide from internal region of human F2RL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey, Bovine, Panda (95%); Gibbon, Dog, Elephant, Pig (89%); Rat, Hamster (84%). |
Rabbit polyclonal anti-F2RL2 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human F2RL2. |
Rabbit Polyclonal Anti-F2RL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2RL2 antibody: synthetic peptide directed towards the C terminal of human F2RL2. Synthetic peptide located within the following region: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK |
F2RL2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PAR3 |