Rabbit polyclonal anti-PTGDR antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PTGDR. |
Rabbit polyclonal anti-PTGDR antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PTGDR. |
Rabbit Polyclonal Anti-PTGDR Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human (Predicted: Monkey) |
Conjugation | Unconjugated |
Immunogen | PTGDR / DP antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human Prostaglandin D2 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (95%); Dog, Pig (85%); Panda, Bovine (80%). |
Rabbit Polyclonal Anti-PTGDR Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human (Predicted: Monkey) |
Conjugation | Unconjugated |
Immunogen | PTGDR / DP antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human Prostaglandin D2 Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Marmoset (95%); Monkey, Panda (85%); Rat, Hamster (80%). |
Rabbit Polyclonal Anti-PTGDR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGDR antibody: synthetic peptide directed towards the C terminal of human PTGDR. Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF |
PTGDR Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |