Antibodies

View as table Download

Rabbit polyclonal anti-PTGDR antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PTGDR.

Rabbit Polyclonal Anti-PTGDR Antibody (Extracellular Domain)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen PTGDR / DP antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human Prostaglandin D2 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (95%); Dog, Pig (85%); Panda, Bovine (80%).

Rabbit Polyclonal Anti-PTGDR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen PTGDR / DP antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human Prostaglandin D2 Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Marmoset (95%); Monkey, Panda (85%); Rat, Hamster (80%).

Rabbit Polyclonal Anti-PTGDR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGDR antibody: synthetic peptide directed towards the C terminal of human PTGDR. Synthetic peptide located within the following region: FKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIF

PTGDR Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated