Antibodies

View as table Download

Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop.

Rabbit Polyclonal Anti-P2RY14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI

Rabbit Polyclonal Anti-P2RY14 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human (Predicted: Monkey, Mouse)
Conjugation Unconjugated
Immunogen P2RY14 / GPR105 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY14 / P2Y14. Percent identity with other species by BLAST analysis: Human (100%); Monkey, Marmoset, Mouse (94%); Rat, Hamster, Panda, Dog, Bat, Rabbit, Pig (88%); Bovine, Horse (81%).

P2RY14 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated