Antibodies

Jump to Filters
View as table Download
GLP2R Rabbit Polyclonal Antibody
TA321635

USD 380.00

2 Weeks

Anti-GLP2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-179 amino acids of human glucagon-like peptide 2 receptor
GLP2R Rabbit Polyclonal Antibody
TA316785

USD 515.00

5 Days

Glp-2 / GLP2R Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen GLP2R / Glp-2 antibody was raised against synthetic 16 amino acid peptide from internal region of human GLP2R. Percent identity with other species by BLAST analysis: Human, Monkey, Marmoset (100%); Gorilla, Gibbon (94%); Rat, Dog, Bovine, Elephant, Panda (81%).
GLP2R (Center) Rabbit Polyclonal Antibody
AP51856PU-N

USD 580.00

2 Weeks

GLP2R (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 219-248 amino acids from the Central region of human GLP2R
GLP2R Rabbit Polyclonal Antibody
TA344324

USD 539.00

5 Days

Rabbit Polyclonal Anti-GLP2R Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLP2R antibody: synthetic peptide directed towards the N terminal of human GLP2R. Synthetic peptide located within the following region: KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP