Rabbit polyclonal anti-GHRHR antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GHRHR. |
Rabbit polyclonal anti-GHRHR antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GHRHR. |
Rabbit Polyclonal Anti-GHRHR Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Mouse, Rat, Hamster, Pig, Rabbit) |
Conjugation | Unconjugated |
Immunogen | GHRHR antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Zebu, Rabbit, Pig (94%); Panda, Bovine, Dog, Horse (88%). |
Rabbit Polyclonal Anti-GHRHR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the N terminal of human GHRHR. Synthetic peptide located within the following region: VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE |
Rabbit Polyclonal Anti-GHRHR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the middle region of human GHRHR. Synthetic peptide located within the following region: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR |
Rabbit Polyclonal Anti-GHRHR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GHRHR antibody: synthetic peptide directed towards the C terminal of human GHRHR. Synthetic peptide located within the following region: YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV |