Antibodies

Jump to Filters
View as table Download
EGF Rabbit Polyclonal Antibody
TA324063

USD 380.00

In Stock

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor
EGF (Center) Rabbit Polyclonal Antibody
AP51384PU-N

USD 580.00

2 Weeks

EGF (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF
EGF Mouse Monoclonal Antibody [Clone ID: KT2]
AM20815PU-N

USD 755.00

In Stock

EGF mouse monoclonal antibody, clone KT2, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
EGF Mouse Monoclonal Antibody [Clone ID: S-147]
AM09150PU-N

USD 695.00

In Stock

EGF mouse monoclonal antibody, clone S-147, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
EGF Rabbit Polyclonal Antibody
TA346085

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY
EGF Goat Polyclonal Antibody
TA329069

USD 520.00

5 Days

Pro-EGF Goat Polyclonal Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Internal region (near the N terminus) (SRQERVCNIEKNVS)
EGF Rabbit Polyclonal Antibody
TA347892

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF
EGF Mouse Monoclonal Antibody [Clone ID: OTI8E2]
TA811558S

USD 200.00

2 Days

EGF mouse monoclonal antibody,clone OTI8E2

Applications WB
Reactivities Human
Conjugation Unconjugated
EGF Rabbit Polyclonal Antibody
PP1002B1

USD 345.00

2 Weeks

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).
EGF Rabbit Polyclonal Antibody
PP1002B2

USD 465.00

2 Weeks

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).
EGF Mouse Monoclonal Antibody [Clone ID: S-120]
AM09147PU-N

USD 695.00

2 Weeks

EGF mouse monoclonal antibody, clone S-120, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
EGF Mouse Monoclonal Antibody [Clone ID: S-145]
AM09148PU-N

USD 695.00

2 Weeks

EGF mouse monoclonal antibody, clone S-145, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
EGF Mouse Monoclonal Antibody [Clone ID: S-146]
AM09149BT-N

USD 760.00

2 Weeks

EGF mouse monoclonal antibody, clone S-146, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin
EGF Mouse Monoclonal Antibody [Clone ID: S-146]
AM09149HR-N

USD 760.00

2 Weeks

EGF mouse monoclonal antibody, clone S-146, HRP

Applications ELISA
Reactivities Human
Conjugation HRP
EGF Mouse Monoclonal Antibody [Clone ID: S-177]
AM09151PU-N

USD 695.00

2 Weeks

EGF mouse monoclonal antibody, clone S-177, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated