Antibodies

View as table Download

Rabbit Polyclonal Anti-LDLR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA

LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated