Rabbit polyclonal BMI1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This BMI1 antibody is generated from rabbits immunized with BMI1 recombinant protein. |
Rabbit polyclonal BMI1 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This BMI1 antibody is generated from rabbits immunized with BMI1 recombinant protein. |
Rabbit Polyclonal Antibody against Bmi1
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region (within residues 1-100) of the human Bmi1 protein. [Swiss-Prot# P35226] |
Rabbit anti-BMI1 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMI1 |
Rabbit Polyclonal Anti-BMI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCGF4 Antibody: synthetic peptide directed towards the C terminal of human PCGF4. Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |