Rabbit Polyclonal Anti-TCF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF19 Antibody: synthetic peptide directed towards the N terminal of human TCF19. Synthetic peptide located within the following region: VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM |
Goat Polyclonal Antibody against TCF19
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSTAKAPSDTPAHE, from the C Terminus of the protein sequence according to NP_009040. |
Rabbit polyclonal antibody to TCF19 (transcription factor 19 (SC1))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 296 and 309 of TCF19 (Uniprot ID#Q9Y242) |
Germany
Japan
United Kingdom
China