Rabbit Polyclonal Anti-SH3KBP1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SH3KBP1 |
Rabbit Polyclonal Anti-SH3KBP1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SH3KBP1 |
Rabbit Polyclonal Anti-SH3KBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SH3KBP1 antibody: synthetic peptide directed towards the N terminal of human SH3KBP1. Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS |