Antibodies

View as table Download

Rabbit Polyclonal antibody to FBXL12 (F-box and leucine-rich repeat protein 12)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 265 and 326 of FBXL12 (Uniprot ID#Q9NXK8)

Goat Anti-FBXL12 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence RACPKESMDWWM, from the C Terminus of the protein sequence according to NP_060173.1.

Rabbit Polyclonal Anti-FBXL12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXL12 antibody: synthetic peptide directed towards the C terminal of human FBXL12. Synthetic peptide located within the following region: PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE