Antibodies

View as table Download

Rabbit polyclonal anti-PC2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 95-107 of Human PC2 protein.

Rabbit Polyclonal CBX4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CBX4 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human CBX4.

Rabbit Polyclonal anti-CBX4 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX4 antibody: synthetic peptide directed towards the N terminal of human CBX4. Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD

Rabbit Polyclonal Anti-CBX4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX4

Rabbit anti-CBX4 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH