Antibodies

View as table Download

Anti-ABCF3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 518-707 amino acids of human ATP-binding cassette, sub-family F (GCN20), member 3

Anti-ABCF3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 518-707 amino acids of human ATP-binding cassette, sub-family F (GCN20), member 3

Rabbit anti-ABCF3 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCF3.

Rabbit Polyclonal Anti-ABCF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCF3 Antibody: synthetic peptide directed towards the N terminal of human ABCF3. Synthetic peptide located within the following region: DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL