Antibodies

View as table Download

PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), Biotinylated

Applications WB
Reactivities Human, Mouse
Conjugation Biotin

PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), HRP conjugated

Applications WB
Reactivities Human, Mouse
Conjugation HRP

PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), Biotinylated

Applications WB
Reactivities Human, Mouse
Conjugation Biotin

PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), HRP conjugated

Applications WB
Reactivities Human, Mouse
Conjugation HRP

Rabbit Polyclonal Anti-PTCH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTCH2 antibody: synthetic peptide directed towards the N terminal of human PTCH2. Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV

PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated