Antibodies

View as table Download

FH (176-189) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Chicken, Drosophila, Equine, Hamster, Insect, Monkey, Porcine, Sheep, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human FH

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL

Mouse monoclonal Hsp90 Antibody

Applications IHC
Reactivities Human, Rabbit, Rat, Mouse, Chicken, Insect, Fungi, Plant
Conjugation Unconjugated