Antibodies

Jump to Filters
View as table Download
CD1E (Center) Rabbit Polyclonal Antibody
AP50840PU-N

USD 580.00

2 Weeks

CD1E (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 274-304 amino acids from the Central region of human CD1E
CD1E Rabbit Polyclonal Antibody
TA343311

USD 539.00

5 Days

Rabbit Polyclonal Anti-CD1E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD1E antibody is: synthetic peptide directed towards the C-terminal region of Human CD1E. Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
CD1E Rabbit Polyclonal Antibody
TA313573

USD 380.00

In Stock

Rabbit polyclonal anti-CD1E antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD1E.
CD1E Rabbit Polyclonal Antibody
TA362080

USD 539.00

5 Days

CD1E Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CD1E