RBL1 mouse monoclonal antibody,clone OTI4E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBL1 mouse monoclonal antibody,clone OTI4E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBL1 mouse monoclonal antibody,clone OTI4A10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBL1 mouse monoclonal antibody,clone OTI4E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
RBL1 mouse monoclonal antibody,clone OTI4E1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
RBL1 mouse monoclonal antibody,clone OTI4E1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) RBL1 mouse monoclonal antibody,clone OTI4A10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
RBL1 mouse monoclonal antibody,clone OTI4A10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
RBL1 mouse monoclonal antibody,clone OTI4A10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RBL1 mouse monoclonal antibody,clone OTI4E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RBL1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the N terminal of human RBL1. Synthetic peptide located within the following region: FLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIG |
Rabbit Polyclonal Anti-RBL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBL1 antibody: synthetic peptide directed towards the middle region of human RBL1. Synthetic peptide located within the following region: NTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHS |
RBL1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RBL1 |
RBL1 mouse monoclonal antibody,clone OTI4A10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |