Antibodies

View as table Download

Anti-PPME1 mouse monoclonal antibody, clone OTI4A12 (formerly 4A12), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-PPME1 mouse monoclonal antibody, clone OTI4A12 (formerly 4A12), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Carrier-free (BSA/glycerol-free) PPME1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PPME1 mouse monoclonal antibody, clone OTI6H5 (formerly 6H5), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PPME1 mouse monoclonal antibody, clone OTI7F12 (formerly 7F12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Caspase 10 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 10.

Rabbit Polyclonal Anti-PPME1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPME1 antibody: synthetic peptide directed towards the N terminal of human PPME1. Synthetic peptide located within the following region: PGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHG

Anti-PPME1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PPME1 mouse monoclonal antibody, clone OTI4A12 (formerly 4A12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PPME1 mouse monoclonal antibody, clone OTI6H5 (formerly 6H5)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated