Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) HACE1 mouse monoclonal antibody,clone OTI10D3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HACE1 mouse monoclonal antibody,clone OTI3F5, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HACE1 mouse monoclonal antibody,clone OTI3F5, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HACE1 mouse monoclonal antibody,clone OTI4F10, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HACE1 mouse monoclonal antibody,clone OTI4F10, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HACE1 mouse monoclonal antibody,clone OTI2C7, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HACE1 mouse monoclonal antibody,clone OTI2C7, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HACE1 mouse monoclonal antibody,clone OTI10D3, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HACE1 mouse monoclonal antibody,clone OTI10D3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit Polyclonal Anti-HACE1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HACE1

HACE1 mouse monoclonal antibody,clone OTI4E10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HACE1 mouse monoclonal antibody,clone OTI6H8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HACE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1. Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV

Rabbit Polyclonal Anti-HACE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HACE1 antibody is: synthetic peptide directed towards the N-terminal region of Human HACE1. Synthetic peptide located within the following region: RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR

HACE1 mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated