Goat Polyclonal Anti-TUBA4A Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 80 aa to the N-terminus of human alpha tubulin produced in E. coli. |
alpha Tubulin (TUBA1A) mouse monoclonal antibody, clone Tub-1, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal TUBA1/3/4 (Ab-272) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TUBA1/3/4 around the phosphorylation site of tyrosine 272 (A-T-YP-A-P). |
Rabbit Polyclonal Tubulin alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tubulin alpha |
Mouse Monoclonal Anti-alpha-Tubulin Antibody [2B11]
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Alpha-tubulin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
Rabbit Polyclonal Anti-TUBA3C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH |
Rabbit Polyclonal Anti-Tubulin alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tubulin alpha Antibody: A synthesized peptide derived from human Tubulin alpha |
Rabbit anti Tubulin alpha Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to aa 426-450 of human tubulin. This sequence is identical among human, rat, mouse, bovine, guinea pig, gerbil, frog and chicken. |
Mouse anti Tubulin-a Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Zebrafish |
| Conjugation | Biotin |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
TUBA3D Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TUBA3D |
TUBA4A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TUBA4A |
Germany
Japan
United Kingdom
China
