USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI 1B11 (formerly 1B11), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated
Applications | WB |
Reactivities | Human, Dog, Rat, Monkey |
Conjugation | Biotin |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated
Applications | WB |
Reactivities | Human, Dog, Rat, Monkey |
Conjugation | HRP |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ALDH3A2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
USD 200.00
2 Days
ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ALDH3A2 |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Goat Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |