Antibodies

View as table Download

Rabbit Polyclonal ZBTB9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ZBTB9 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ZBTB9.

Rabbit Polyclonal Anti-ZBTB9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the N terminal of human ZBTB9. Synthetic peptide located within the following region: METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDV

Rabbit Polyclonal Anti-ZBTB9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the C terminal of human ZBTB9. Synthetic peptide located within the following region: HHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQGWATAHWTYK

Zbtb9 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated