Antibodies

View as table Download

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ

Rabbit Polyclonal anti-GTF2F2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the C terminal of human GTF2F2. Synthetic peptide located within the following region: KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated