Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TAF10 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TAF10 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to C-Terminal portion of human TAF10. |
TAF10 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish, African clawed frog |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10 |
Rabbit Polyclonal anti-TAF10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the middle region of human TAF10. Synthetic peptide located within the following region: GFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRK |
Rabbit Polyclonal anti-TAF10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10. Synthetic peptide located within the following region: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT |
Active filters
Target Symbol
- TAF10
Conjugates
- Unconjugated