Antibodies

View as table Download

SYT16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SYT16

SYT16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SYT16

Rabbit polyclonal anti-SYT16 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SYT16.

Rabbit Polyclonal Anti-SYT16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYT16 antibody: synthetic peptide directed towards the N terminal of human SYT16. Synthetic peptide located within the following region: DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD