Antibodies

View as table Download

SURF6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SURF6

Rabbit Polyclonal Anti-SURF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SURF6 antibody: synthetic peptide directed towards the middle region of human SURF6. Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL

SURF6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SURF6

Rabbit Polyclonal Anti-SURF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SURF6 antibody: synthetic peptide directed towards the N terminal of human SURF6. Synthetic peptide located within the following region: ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA