Antibodies

Jump to Filters
View as table Download
PCDHB14 (N-term) Rabbit Polyclonal Antibody
AP53209PU-N

USD 580.00

2 Weeks

PCDHB14 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 165-193aa) of human PCDHB14.
PCDHB14 Rabbit Polyclonal Antibody
TA331067

USD 539.00

5 Days

Rabbit polyclonal Anti-PCDHB14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCDHB14 antibody is: synthetic peptide directed towards the middle region of Human PCDHB14. Synthetic peptide located within the following region: YGKISYTFFHASEDIRKTFEINPISGEVNLRSPLDFEVIQSYTINIQATD