Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PAK4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAK4 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAK4 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAK4 mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Phospho-PAK4/5/6 (Ser474/Ser560/Ser602) Rabbit polyclonal Antibody
| Applications | FC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Phospho-PAK4 + PAK5 + PAK6 (S474 + S560 + S602) (Phosphorylated) |
PAK4 (incl. pos. control) mouse monoclonal antibody, clone 6C1, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
PAK4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Pak4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pak4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR |
Active filters
Target Symbol
- PAK4
Conjugates
- Unconjugated