LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI8B2 (formerly 8B2)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI8B2 (formerly 8B2)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Loxl2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Loxl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA |
LOXL2 mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LOXL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LOXL2 |
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LOXL2 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Mouse, Rat, Chicken) |
Conjugation | Unconjugated |
Immunogen | LOXL2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Horse, Rabbit (100%); Mouse, Rat, Opossum, Turkey, Chicken, Platypus (93%); Xenopus, Pufferfish, Zebrafish, Stickleback (87%). |
Rabbit Polyclonal Anti-LOXL2 Antibody (Internal)
Applications | IHC |
Reactivities | Human (Predicted: Bat) |
Conjugation | Unconjugated |
Immunogen | LOXL2 antibody was raised against synthetic 20 amino acid peptide from internal region of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Guinea pig (100%); Bat (95%). |